PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr039075.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 474aa    MW: 52184.1 Da    PI: 8.7962
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr039075.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding513.3e-16130175147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed +l+++v+++G+ +W++Ia+++  gR++k+c++rw++ 
      Pbr039075.1 130 RGHWRPAEDSKLKELVALYGPQNWNLIAEKLE-GRSGKSCRLRWFNQ 175
                      899*****************************.***********996 PP

2Myb_DNA-binding52.11.5e-16182225146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++T+eE+e+l + ++ +G++ W+ Iar ++ gRt++ +k++w+ 
      Pbr039075.1 182 RRAFTEEEEERLMQTHRIYGNK-WAMIARLFP-GRTDNAVKNHWHV 225
                      678*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.17125176IPR017930Myb domain
SMARTSM007172.9E-14129178IPR001005SANT/Myb domain
SuperFamilySSF466898.24E-28130223IPR009057Homeodomain-like
PfamPF002491.0E-15130175IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.3E-26131183IPR009057Homeodomain-like
CDDcd001675.02E-13133174No hitNo description
PROSITE profilePS5129426.525177231IPR017930Myb domain
SMARTSM007177.7E-13181229IPR001005SANT/Myb domain
PfamPF002492.8E-13182224IPR001005SANT/Myb domain
CDDcd001672.23E-10184224No hitNo description
Gene3DG3DSA:1.10.10.602.9E-20184230IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 474 aa     Download sequence    Send to blast
MMANNGAIYV TETPNTLSRF SSSSSSSSSS SSSMGMVYAD MGSLSLSSKY GVYSSVSSQD  60
SSHISKISES ENGRAFWGFP STRSYEDHHN SSDMKGSDYT SSDHDKNPNE SGVKVSEKET  120
ESGQSKLCAR GHWRPAEDSK LKELVALYGP QNWNLIAEKL EGRSGKSCRL RWFNQLDPRI  180
NRRAFTEEEE ERLMQTHRIY GNKWAMIARL FPGRTDNAVK NHWHVIMARK YREQSSAYRR  240
RKLNQTVYRS MEENPSFNAA SSTEPPPPYG GLSLPNGGLG GSGSISSFSY GTSYDGIVGY  300
GADYYGSNGS QNLISVEEEA ITRKKLLSHN NSGFCSQQKT PFEFFRGPKS NEVMGMMSQN  360
RCWDGSGEME GHSYGGMYTH HPPPNMNVTT MQQSNFHSLV HQKYSDSSCQ VSGGEPSPSA  420
SAADRVVGGG GGGGGHPXXX XXXXXXXXXX XXXXXAATVR RAFRHRPSLI FLG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-331302307107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00222DAPTransfer from AT1G69560Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008350925.10.0PREDICTED: myb-related protein Hv33-like
RefseqXP_008389457.10.0PREDICTED: myb-related protein Hv33-like
TrEMBLD9ZJ600.0D9ZJ60_MALDO; MYB domain class transcription factor
STRINGVIT_01s0026g02600.t011e-144(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23034243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.12e-77myb domain protein 105